$ cat recipes/juniper-winter-french-miso-scallion-egg-muffin-plate-074069.md

Juniper Winter French Miso Scallion Egg Muffin Plate No. 074069

Name: Juniper Winter French Miso Scallion Egg Muffin Plate No. 074069
Prep time: 10 min
Cook time: 12 min
Total time: 22 min
Yield: 5 servings
Ingredients: juniper winter french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Winter French Miso Scallion Egg Muffin Plate No. 074069 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Winter French Miso Scallion Egg Muffin Plate No. 074069

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       12 min
total      22 min
servings   5
protein    37 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal626

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.