$ cat recipes/juniper-winter-indian-coconut-lime-toast-bake-070509.md

Juniper Winter Indian Coconut Lime Toast Bake No. 070509

Name: Juniper Winter Indian Coconut Lime Toast Bake No. 070509
Prep time: 22 min
Cook time: 20 min
Total time: 42 min
Yield: 5 servings
Ingredients: juniper winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Winter Indian Coconut Lime Toast Bake No. 070509 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Winter Indian Coconut Lime Toast Bake No. 070509

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       20 min
total      42 min
servings   5
protein    21 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal226

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.