$ cat recipes/juniper-winter-korean-coconut-lime-scramble-stack-073879.md

Juniper Winter Korean Coconut Lime Scramble Stack No. 073879

Name: Juniper Winter Korean Coconut Lime Scramble Stack No. 073879
Prep time: 12 min
Cook time: 12 min
Total time: 24 min
Yield: 5 servings
Ingredients: juniper winter korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Winter Korean Coconut Lime Scramble Stack No. 073879 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Winter Korean Coconut Lime Scramble Stack No. 073879

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       12 min
total      24 min
servings   5
protein    37 g
pantry     96/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.