$ cat recipes/juniper-winter-mexican-sweet-potato-toast-stack-073074.md

Juniper Winter Mexican Sweet Potato Toast Stack No. 073074

Name: Juniper Winter Mexican Sweet Potato Toast Stack No. 073074
Prep time: 17 min
Cook time: 39 min
Total time: 56 min
Yield: 5 servings
Ingredients: juniper winter mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Winter Mexican Sweet Potato Toast Stack No. 073074 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Winter Mexican Sweet Potato Toast Stack No. 073074

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       39 min
total      56 min
servings   5
protein    40 g
pantry     97/100

categorybreakfastdietpescatarianlevelmediumkcal561

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.