$ cat recipes/lantern-fall-brazilian-pesto-kale-overnight-oat-cup-030639.md

Lantern Fall Brazilian Pesto Kale Overnight Oat Cup

Name: Lantern Fall Brazilian Pesto Kale Overnight Oat Cup
Prep time: 26 min
Cook time: 40 min
Total time: 66 min
Yield: 5 servings
Ingredients: lantern fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Fall Brazilian Pesto Kale Overnight Oat Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Fall Brazilian Pesto Kale Overnight Oat Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       40 min
total      66 min
servings   5
protein    19 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal426

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.