$ cat recipes/lantern-fall-british-lemon-herb-oat-cup-030734.md

Lantern Fall British Lemon Herb Oat Cup

Name: Lantern Fall British Lemon Herb Oat Cup
Prep time: 25 min
Cook time: 21 min
Total time: 46 min
Yield: 5 servings
Ingredients: lantern fall british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Fall British Lemon Herb Oat Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Fall British Lemon Herb Oat Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       21 min
total      46 min
servings   5
protein    38 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal511

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.