$ cat recipes/lantern-fall-french-pesto-kale-egg-muffin-hash-034099.md

Lantern Fall French Pesto Kale Egg Muffin Hash

Name: Lantern Fall French Pesto Kale Egg Muffin Hash
Prep time: 22 min
Cook time: 16 min
Total time: 38 min
Yield: 5 servings
Ingredients: lantern fall french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Fall French Pesto Kale Egg Muffin Hash is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Fall French Pesto Kale Egg Muffin Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       16 min
total      38 min
servings   5
protein    29 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.