$ cat recipes/lantern-fall-indian-spinach-feta-scramble-plate-037869.md

Lantern Fall Indian Spinach Feta Scramble Plate

Name: Lantern Fall Indian Spinach Feta Scramble Plate
Prep time: 24 min
Cook time: 34 min
Total time: 58 min
Yield: 5 servings
Ingredients: lantern fall indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Fall Indian Spinach Feta Scramble Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Lantern Fall Indian Spinach Feta Scramble Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       34 min
total      58 min
servings   5
protein    31 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal396

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.