$ cat recipes/lantern-fall-mediterranean-pesto-kale-oat-stack-031724.md

Lantern Fall Mediterranean Pesto Kale Oat Stack

Name: Lantern Fall Mediterranean Pesto Kale Oat Stack
Prep time: 25 min
Cook time: 35 min
Total time: 60 min
Yield: 5 servings
Ingredients: lantern fall mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Fall Mediterranean Pesto Kale Oat Stack is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Fall Mediterranean Pesto Kale Oat Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       35 min
total      60 min
servings   5
protein    10 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal391

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.