$ cat recipes/lantern-fall-taiwanese-miso-scallion-overnight-oat-bake-033609.md

Lantern Fall Taiwanese Miso Scallion Overnight Oat Bake

Name: Lantern Fall Taiwanese Miso Scallion Overnight Oat Bake
Prep time: 26 min
Cook time: 44 min
Total time: 70 min
Yield: 5 servings
Ingredients: lantern fall taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Fall Taiwanese Miso Scallion Overnight Oat Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Fall Taiwanese Miso Scallion Overnight Oat Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       44 min
total      70 min
servings   5
protein    11 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern fall taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.