$ cat recipes/lantern-holiday-british-miso-scallion-yogurt-cup-stack-038979.md

Lantern Holiday British Miso Scallion Yogurt Cup Stack

Name: Lantern Holiday British Miso Scallion Yogurt Cup Stack
Prep time: 10 min
Cook time: 14 min
Total time: 24 min
Yield: 5 servings
Ingredients: lantern holiday british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Holiday British Miso Scallion Yogurt Cup Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Holiday British Miso Scallion Yogurt Cup Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       14 min
total      24 min
servings   5
protein    33 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal306

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.