$ cat recipes/lantern-holiday-mediterranean-sweet-potato-toast-stack-038074.md

Lantern Holiday Mediterranean Sweet Potato Toast Stack

Name: Lantern Holiday Mediterranean Sweet Potato Toast Stack
Prep time: 23 min
Cook time: 25 min
Total time: 48 min
Yield: 5 servings
Ingredients: lantern holiday mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Holiday Mediterranean Sweet Potato Toast Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Holiday Mediterranean Sweet Potato Toast Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       25 min
total      48 min
servings   5
protein    30 g
pantry     87/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.