$ cat recipes/lantern-holiday-mexican-corn-pepper-scramble-bake-035809.md

Lantern Holiday Mexican Corn Pepper Scramble Bake

Name: Lantern Holiday Mexican Corn Pepper Scramble Bake
Prep time: 26 min
Cook time: 16 min
Total time: 42 min
Yield: 5 servings
Ingredients: lantern holiday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Holiday Mexican Corn Pepper Scramble Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Holiday Mexican Corn Pepper Scramble Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       16 min
total      42 min
servings   5
protein    29 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal616

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.