$ cat recipes/lantern-holiday-mexican-miso-scallion-breakfast-wrap-hash-031244.md

Lantern Holiday Mexican Miso Scallion Breakfast Wrap Hash

Name: Lantern Holiday Mexican Miso Scallion Breakfast Wrap Hash
Prep time: 15 min
Cook time: 19 min
Total time: 34 min
Yield: 5 servings
Ingredients: lantern holiday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Holiday Mexican Miso Scallion Breakfast Wrap Hash is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Holiday Mexican Miso Scallion Breakfast Wrap Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       19 min
total      34 min
servings   5
protein    42 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal271

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.