$ cat recipes/lantern-holiday-mexican-spinach-feta-overnight-oat-cup-032134.md

Lantern Holiday Mexican Spinach Feta Overnight Oat Cup

Name: Lantern Holiday Mexican Spinach Feta Overnight Oat Cup
Prep time: 23 min
Cook time: 17 min
Total time: 40 min
Yield: 5 servings
Ingredients: lantern holiday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Holiday Mexican Spinach Feta Overnight Oat Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Holiday Mexican Spinach Feta Overnight Oat Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       17 min
total      40 min
servings   5
protein    8 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal371

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.