$ cat recipes/lantern-holiday-ontario-garlic-butter-scramble-cup-037384.md

Lantern Holiday Ontario Garlic Butter Scramble Cup

Name: Lantern Holiday Ontario Garlic Butter Scramble Cup
Prep time: 21 min
Cook time: 21 min
Total time: 42 min
Yield: 5 servings
Ingredients: lantern holiday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Holiday Ontario Garlic Butter Scramble Cup is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Holiday Ontario Garlic Butter Scramble Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       21 min
cook       21 min
total      42 min
servings   5
protein    38 g
pantry     82/100

categorybreakfastdietpescatarianleveleasykcal581

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.