$ cat recipes/lantern-holiday-ontario-sesame-ginger-yogurt-cup-hash-036494.md

Lantern Holiday Ontario Sesame Ginger Yogurt Cup Hash

Name: Lantern Holiday Ontario Sesame Ginger Yogurt Cup Hash
Prep time: 13 min
Cook time: 23 min
Total time: 36 min
Yield: 5 servings
Ingredients: lantern holiday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Holiday Ontario Sesame Ginger Yogurt Cup Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Holiday Ontario Sesame Ginger Yogurt Cup Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       23 min
total      36 min
servings   5
protein    34 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal481

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern holiday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.