$ cat recipes/lantern-late-night-indian-sesame-ginger-overnight-oat-stack-039679.md

Lantern Late-Night Indian Sesame Ginger Overnight Oat Stack

Name: Lantern Late-Night Indian Sesame Ginger Overnight Oat Stack
Prep time: 20 min
Cook time: 12 min
Total time: 32 min
Yield: 5 servings
Ingredients: lantern late-night indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Late-Night Indian Sesame Ginger Overnight Oat Stack is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Late-Night Indian Sesame Ginger Overnight Oat Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       12 min
total      32 min
servings   5
protein    37 g
pantry     71/100

categorybreakfastdietpescatarianleveleasykcal236

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern late-night indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.