$ cat recipes/lantern-late-night-korean-garlic-butter-scramble-cup-033839.md

Lantern Late-Night Korean Garlic Butter Scramble Cup

Name: Lantern Late-Night Korean Garlic Butter Scramble Cup
Prep time: 12 min
Cook time: 20 min
Total time: 32 min
Yield: 5 servings
Ingredients: lantern late-night korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Late-Night Korean Garlic Butter Scramble Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Late-Night Korean Garlic Butter Scramble Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       20 min
total      32 min
servings   5
protein    21 g
pantry     78/100

categorybreakfastdietpescatarianlevelmediumkcal246

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern late-night korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.