$ cat recipes/lantern-lunchbox-british-lemon-herb-toast-bake-032559.md

Lantern Lunchbox British Lemon Herb Toast Bake

Name: Lantern Lunchbox British Lemon Herb Toast Bake
Prep time: 22 min
Cook time: 28 min
Total time: 50 min
Yield: 5 servings
Ingredients: lantern lunchbox british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Lunchbox British Lemon Herb Toast Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Lunchbox British Lemon Herb Toast Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       28 min
total      50 min
servings   5
protein    43 g
pantry     61/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern lunchbox british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.