$ cat recipes/lantern-lunchbox-korean-corn-pepper-overnight-oat-stack-035629.md

Lantern Lunchbox Korean Corn Pepper Overnight Oat Stack

Name: Lantern Lunchbox Korean Corn Pepper Overnight Oat Stack
Prep time: 14 min
Cook time: 10 min
Total time: 24 min
Yield: 5 servings
Ingredients: lantern lunchbox korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Lunchbox Korean Corn Pepper Overnight Oat Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Lunchbox Korean Corn Pepper Overnight Oat Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       10 min
total      24 min
servings   5
protein    41 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal326

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern lunchbox korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.