$ cat recipes/lantern-lunchbox-mexican-lemon-herb-egg-stack-035824.md

Lantern Lunchbox Mexican Lemon Herb Egg Stack

Name: Lantern Lunchbox Mexican Lemon Herb Egg Stack
Prep time: 27 min
Cook time: 45 min
Total time: 72 min
Yield: 5 servings
Ingredients: lantern lunchbox mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Lunchbox Mexican Lemon Herb Egg Stack is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Lunchbox Mexican Lemon Herb Egg Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       45 min
total      72 min
servings   5
protein    28 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal191

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern lunchbox mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.