$ cat recipes/lantern-lunchbox-ontario-garlic-butter-breakfast-wrap-hash-033749.md

Lantern Lunchbox Ontario Garlic Butter Breakfast Wrap Hash

Name: Lantern Lunchbox Ontario Garlic Butter Breakfast Wrap Hash
Prep time: 6 min
Cook time: 36 min
Total time: 42 min
Yield: 5 servings
Ingredients: lantern lunchbox ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Lunchbox Ontario Garlic Butter Breakfast Wrap Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Lunchbox Ontario Garlic Butter Breakfast Wrap Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       36 min
total      42 min
servings   5
protein    27 g
pantry     72/100

categorybreakfastdietpescatarianleveleasykcal346

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern lunchbox ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.