$ cat recipes/lantern-market-day-korean-sesame-ginger-egg-bake-038309.md

Lantern Market-Day Korean Sesame Ginger Egg Bake

Name: Lantern Market-Day Korean Sesame Ginger Egg Bake
Prep time: 24 min
Cook time: 36 min
Total time: 60 min
Yield: 5 servings
Ingredients: lantern market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Market-Day Korean Sesame Ginger Egg Bake is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Market-Day Korean Sesame Ginger Egg Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       36 min
total      60 min
servings   5
protein    27 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal506

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.