$ cat recipes/lantern-market-day-mexican-sweet-potato-overnight-oat-plate-037619.md

Lantern Market-Day Mexican Sweet Potato Overnight Oat Plate

Name: Lantern Market-Day Mexican Sweet Potato Overnight Oat Plate
Prep time: 22 min
Cook time: 32 min
Total time: 54 min
Yield: 5 servings
Ingredients: lantern market-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Market-Day Mexican Sweet Potato Overnight Oat Plate is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Market-Day Mexican Sweet Potato Overnight Oat Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       32 min
total      54 min
servings   5
protein    35 g
pantry     84/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern market-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.