$ cat recipes/lantern-market-day-mexican-sweet-potato-smoothie-plate-032169.md

Lantern Market-Day Mexican Sweet Potato Smoothie Plate

Name: Lantern Market-Day Mexican Sweet Potato Smoothie Plate
Prep time: 18 min
Cook time: 34 min
Total time: 52 min
Yield: 5 servings
Ingredients: lantern market-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Market-Day Mexican Sweet Potato Smoothie Plate is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Market-Day Mexican Sweet Potato Smoothie Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       34 min
total      52 min
servings   5
protein    31 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal196

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern market-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.