$ cat recipes/lantern-rainy-day-french-lemon-herb-toast-bake-034004.md

Lantern Rainy-Day French Lemon Herb Toast Bake

Name: Lantern Rainy-Day French Lemon Herb Toast Bake
Prep time: 23 min
Cook time: 35 min
Total time: 58 min
Yield: 5 servings
Ingredients: lantern rainy-day french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Rainy-Day French Lemon Herb Toast Bake is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Rainy-Day French Lemon Herb Toast Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       35 min
total      58 min
servings   5
protein    10 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern rainy-day french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.