$ cat recipes/lantern-rainy-day-indian-coconut-lime-scramble-stack-037879.md

Lantern Rainy-Day Indian Coconut Lime Scramble Stack

Name: Lantern Rainy-Day Indian Coconut Lime Scramble Stack
Prep time: 10 min
Cook time: 28 min
Total time: 38 min
Yield: 5 servings
Ingredients: lantern rainy-day indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Rainy-Day Indian Coconut Lime Scramble Stack is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Rainy-Day Indian Coconut Lime Scramble Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       28 min
total      38 min
servings   5
protein    43 g
pantry     74/100

categorybreakfastdietpescatarianleveleasykcal276

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern rainy-day indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.