$ cat recipes/lantern-rainy-day-japanese-corn-pepper-egg-bake-039359.md

Lantern Rainy-Day Japanese Corn Pepper Egg Bake

Name: Lantern Rainy-Day Japanese Corn Pepper Egg Bake
Prep time: 6 min
Cook time: 14 min
Total time: 20 min
Yield: 5 servings
Ingredients: lantern rainy-day japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Rainy-Day Japanese Corn Pepper Egg Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Rainy-Day Japanese Corn Pepper Egg Bake

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       6 min
cook       14 min
total      20 min
servings   5
protein    33 g
pantry     77/100

categorybreakfastdietpescatarianleveleasykcal646

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern rainy-day japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.