$ cat recipes/lantern-spring-japanese-coconut-lime-egg-stack-034874.md

Lantern Spring Japanese Coconut Lime Egg Stack

Name: Lantern Spring Japanese Coconut Lime Egg Stack
Prep time: 15 min
Cook time: 45 min
Total time: 60 min
Yield: 5 servings
Ingredients: lantern spring japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Spring Japanese Coconut Lime Egg Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Spring Japanese Coconut Lime Egg Stack

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       15 min
cook       45 min
total      60 min
servings   5
protein    28 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal321

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern spring japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.