$ cat recipes/lantern-spring-ontario-garlic-butter-toast-plate-035569.md

Lantern Spring Ontario Garlic Butter Toast Plate

Name: Lantern Spring Ontario Garlic Butter Toast Plate
Prep time: 10 min
Cook time: 8 min
Total time: 18 min
Yield: 5 servings
Ingredients: lantern spring ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Spring Ontario Garlic Butter Toast Plate is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Spring Ontario Garlic Butter Toast Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       8 min
total      18 min
servings   5
protein    7 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern spring ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.