$ cat recipes/lantern-spring-taiwanese-tomato-basil-egg-muffin-stack-039029.md

Lantern Spring Taiwanese Tomato Basil Egg Muffin Stack

Name: Lantern Spring Taiwanese Tomato Basil Egg Muffin Stack
Prep time: 6 min
Cook time: 22 min
Total time: 28 min
Yield: 5 servings
Ingredients: lantern spring taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Spring Taiwanese Tomato Basil Egg Muffin Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Spring Taiwanese Tomato Basil Egg Muffin Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       22 min
total      28 min
servings   5
protein    17 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal196

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern spring taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.