$ cat recipes/lantern-summer-japanese-miso-scallion-scramble-cup-034889.md

Lantern Summer Japanese Miso Scallion Scramble Cup

Name: Lantern Summer Japanese Miso Scallion Scramble Cup
Prep time: 16 min
Cook time: 36 min
Total time: 52 min
Yield: 5 servings
Ingredients: lantern summer japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Summer Japanese Miso Scallion Scramble Cup is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Summer Japanese Miso Scallion Scramble Cup

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       16 min
cook       36 min
total      52 min
servings   5
protein    27 g
pantry     66/100

categorybreakfastdietpescatarianlevelmediumkcal386

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern summer japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.