mdrecipesmd.com
back to 100kweight-losspescatarian

$ cat recipes/lantern-summer-mediterranean-corn-pepper-breakfast-wrap-plate-036264.md

Lantern Summer Mediterranean Corn Pepper Breakfast Wrap Plate

^_^ cozy - Lantern Summer Mediterranean Corn Pepper Breakfast Wrap Plate is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly
categorybreakfastdietpescatarianleveleasykcal301

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

  • lantern summer mediterranean
  • rolled oats
  • parsley
  • cumin
  • olive oil
  • kosher salt
  • black pepper
  • garlic
  • lemon

Steps

  1. Prep all vegetables, aromatics, and protein before heat touches the pan.
  2. Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
  3. Add liquid or sauce in stages, tasting once midway and once before serving.
  4. Plate hot with herbs, acid, and a final grind of pepper.