$ cat recipes/lantern-summer-ontario-miso-scallion-breakfast-wrap-hash-033799.md

Lantern Summer Ontario Miso Scallion Breakfast Wrap Hash

Name: Lantern Summer Ontario Miso Scallion Breakfast Wrap Hash
Prep time: 24 min
Cook time: 44 min
Total time: 68 min
Yield: 5 servings
Ingredients: lantern summer ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Summer Ontario Miso Scallion Breakfast Wrap Hash is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Summer Ontario Miso Scallion Breakfast Wrap Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       44 min
total      68 min
servings   5
protein    11 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal236

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern summer ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.