$ cat recipes/lantern-summer-taiwanese-sesame-ginger-egg-muffin-cup-039039.md

Lantern Summer Taiwanese Sesame Ginger Egg Muffin Cup

Name: Lantern Summer Taiwanese Sesame Ginger Egg Muffin Cup
Prep time: 14 min
Cook time: 16 min
Total time: 30 min
Yield: 5 servings
Ingredients: lantern summer taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Summer Taiwanese Sesame Ginger Egg Muffin Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Summer Taiwanese Sesame Ginger Egg Muffin Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       16 min
total      30 min
servings   5
protein    29 g
pantry     83/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern summer taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.