$ cat recipes/lantern-sunday-brazilian-coconut-lime-overnight-oat-hash-030699.md

Lantern Sunday Brazilian Coconut Lime Overnight Oat Hash

Name: Lantern Sunday Brazilian Coconut Lime Overnight Oat Hash
Prep time: 8 min
Cook time: 42 min
Total time: 50 min
Yield: 5 servings
Ingredients: lantern sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Sunday Brazilian Coconut Lime Overnight Oat Hash is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Sunday Brazilian Coconut Lime Overnight Oat Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       42 min
total      50 min
servings   5
protein    15 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal196

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.