$ cat recipes/lantern-sunday-indian-spinach-feta-toast-hash-030599.md

Lantern Sunday Indian Spinach Feta Toast Hash

Name: Lantern Sunday Indian Spinach Feta Toast Hash
Prep time: 16 min
Cook time: 26 min
Total time: 42 min
Yield: 5 servings
Ingredients: lantern sunday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Sunday Indian Spinach Feta Toast Hash is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Sunday Indian Spinach Feta Toast Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       26 min
total      42 min
servings   5
protein    9 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.