$ cat recipes/lantern-sunday-japanese-sweet-potato-toast-stack-037529.md

Lantern Sunday Japanese Sweet Potato Toast Stack

Name: Lantern Sunday Japanese Sweet Potato Toast Stack
Prep time: 16 min
Cook time: 10 min
Total time: 26 min
Yield: 5 servings
Ingredients: lantern sunday japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Sunday Japanese Sweet Potato Toast Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Sunday Japanese Sweet Potato Toast Stack

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       16 min
cook       10 min
total      26 min
servings   5
protein    41 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.