$ cat recipes/lantern-sunday-korean-miso-scallion-pancake-stack-032974.md

Lantern Sunday Korean Miso Scallion Pancake Stack

Name: Lantern Sunday Korean Miso Scallion Pancake Stack
Prep time: 13 min
Cook time: 45 min
Total time: 58 min
Yield: 5 servings
Ingredients: lantern sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Sunday Korean Miso Scallion Pancake Stack is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Sunday Korean Miso Scallion Pancake Stack

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       13 min
cook       45 min
total      58 min
servings   5
protein    28 g
pantry     75/100

categorybreakfastdietpescatarianleveleasykcal581

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.