$ cat recipes/lantern-sunday-korean-tomato-basil-oat-bake-034754.md

Lantern Sunday Korean Tomato Basil Oat Bake

Name: Lantern Sunday Korean Tomato Basil Oat Bake
Prep time: 7 min
Cook time: 41 min
Total time: 48 min
Yield: 5 servings
Ingredients: lantern sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Sunday Korean Tomato Basil Oat Bake is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Lantern Sunday Korean Tomato Basil Oat Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       41 min
total      48 min
servings   5
protein    36 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal291

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.