$ cat recipes/lantern-sunday-mexican-lemon-herb-breakfast-wrap-cup-031284.md

Lantern Sunday Mexican Lemon Herb Breakfast Wrap Cup

Name: Lantern Sunday Mexican Lemon Herb Breakfast Wrap Cup
Prep time: 25 min
Cook time: 33 min
Total time: 58 min
Yield: 5 servings
Ingredients: lantern sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Sunday Mexican Lemon Herb Breakfast Wrap Cup is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Sunday Mexican Lemon Herb Breakfast Wrap Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       33 min
total      58 min
servings   5
protein    14 g
pantry     58/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.