$ cat recipes/lantern-sunday-mexican-spinach-feta-pancake-bake-034954.md

Lantern Sunday Mexican Spinach Feta Pancake Bake

Name: Lantern Sunday Mexican Spinach Feta Pancake Bake
Prep time: 13 min
Cook time: 35 min
Total time: 48 min
Yield: 5 servings
Ingredients: lantern sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Sunday Mexican Spinach Feta Pancake Bake is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Sunday Mexican Spinach Feta Pancake Bake

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       13 min
cook       35 min
total      48 min
servings   5
protein    10 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.