$ cat recipes/lantern-sunday-ontario-sweet-potato-yogurt-cup-cup-031989.md

Lantern Sunday Ontario Sweet Potato Yogurt Cup Cup

Name: Lantern Sunday Ontario Sweet Potato Yogurt Cup Cup
Prep time: 6 min
Cook time: 28 min
Total time: 34 min
Yield: 5 servings
Ingredients: lantern sunday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Sunday Ontario Sweet Potato Yogurt Cup Cup is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Sunday Ontario Sweet Potato Yogurt Cup Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       28 min
total      34 min
servings   5
protein    43 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal396

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern sunday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.