$ cat recipes/lantern-winter-indian-coconut-lime-egg-muffin-bake-030504.md

Lantern Winter Indian Coconut Lime Egg Muffin Bake

Name: Lantern Winter Indian Coconut Lime Egg Muffin Bake
Prep time: 17 min
Cook time: 45 min
Total time: 62 min
Yield: 5 servings
Ingredients: lantern winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Winter Indian Coconut Lime Egg Muffin Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Winter Indian Coconut Lime Egg Muffin Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       45 min
total      62 min
servings   5
protein    28 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal331

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.