mdrecipesmd.com
back to 300ktrainerpescatarian

$ cat recipes/lantern-winter-indian-garlic-butter-egg-cup-137834.md

Lantern Winter Indian Garlic Butter Egg Cup

^_^ cozy - Lantern Winter Indian Garlic Butter Egg Cup is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free
categorybreakfastdietpescatarianleveleasykcal581

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

  • lantern winter indian
  • rolled oats
  • parsley
  • cumin
  • olive oil
  • kosher salt
  • black pepper
  • garlic
  • lemon

Steps

  1. Prep all vegetables, aromatics, and protein before heat touches the pan.
  2. Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
  3. Add liquid or sauce in stages, tasting once midway and once before serving.
  4. Plate hot with herbs, acid, and a final grind of pepper.