$ cat recipes/lantern-winter-indian-sesame-ginger-pancake-hash-036944.md

Lantern Winter Indian Sesame Ginger Pancake Hash

Name: Lantern Winter Indian Sesame Ginger Pancake Hash
Prep time: 21 min
Cook time: 19 min
Total time: 40 min
Yield: 5 servings
Ingredients: lantern winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Winter Indian Sesame Ginger Pancake Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Lantern Winter Indian Sesame Ginger Pancake Hash

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       19 min
total      40 min
servings   5
protein    42 g
pantry     80/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.