$ cat recipes/lantern-winter-mediterranean-corn-pepper-egg-bake-035359.md

Lantern Winter Mediterranean Corn Pepper Egg Bake

Name: Lantern Winter Mediterranean Corn Pepper Egg Bake
Prep time: 18 min
Cook time: 20 min
Total time: 38 min
Yield: 5 servings
Ingredients: lantern winter mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lantern Winter Mediterranean Corn Pepper Egg Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Winter Mediterranean Corn Pepper Egg Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       20 min
total      38 min
servings   5
protein    21 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal626

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern winter mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.