$ cat recipes/late-night-mexican-garlic-butter-pancake-stack-4924.md

Late-Night Mexican Garlic Butter Pancake Stack

Name: Late-Night Mexican Garlic Butter Pancake Stack
Prep time: 13 min
Cook time: 41 min
Total time: 54 min
Yield: 5 servings
Ingredients: late-night mexican garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Late-Night Mexican Garlic Butter Pancake Stack is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Late-Night Mexican Garlic Butter Pancake Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       13 min
cook       41 min
total      54 min
servings   5
protein    36 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal551

$ price recipe --region auto

Estimating local basket...

Ingredients

late-night mexican garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.