$ cat recipes/late-night-taiwanese-sweet-potato-egg-muffin-stack-4524.md

Late-Night Taiwanese Sweet Potato Egg Muffin Stack

Name: Late-Night Taiwanese Sweet Potato Egg Muffin Stack
Prep time: 23 min
Cook time: 15 min
Total time: 38 min
Yield: 5 servings
Ingredients: late-night taiwanese sweet; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Late-Night Taiwanese Sweet Potato Egg Muffin Stack is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Late-Night Taiwanese Sweet Potato Egg Muffin Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       23 min
cook       15 min
total      38 min
servings   5
protein    12 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal451

$ price recipe --region auto

Estimating local basket...

Ingredients

late-night taiwanese sweet
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.